SCOPe 2.08: Domain d1plba_: 1plb A:

Lineage for d1plba_ (1plb A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (17 species)

7. Species Parsley (Petroselinum crispum) [TaxId:4043] [49510] (2 PDB entries)

8. Domain d1plba_: 1plb A: [22856]
   complexed with cu

Details for d1plba_

PDB Entry: 1plb

PDB Description: high-resolution solution structure of reduced parsley plastocyanin

PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d1plba_:

Sequence; same for both SEQRES and ATOM records:

>d1plba_ b.6.1.1 (A:) Plastocyanin {Parsley (Petroselinum crispum) [TaxId: 4043]}
aevklgsddgglvfspssftvaagekitfknnagfphnivfdedevpagvnaekisqpey
lngagetyevtltekgtykfycephagagmkgevtvn

Timeline for d1plba_:

• d1plba_ first appeared (with stable ids) in SCOP 1.55, called d1plb__
  
• d1plba_ appears in SCOPe 2.07