SCOPe 2.07: Domain d4mlfd_: 4mlf D:

Lineage for d4mlfd_ (4mlf D:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.15: Leech antihemostatic proteins [57262] (3 families)

5. Family g.3.15.2: Hirudin-like [57270] (4 proteins)

6. Protein Hirudin [57271] (1 species)

7. Species Medicinal leech (Hirudo medicinalis) [TaxId:6421] [57272] (9 PDB entries)

8. Domain d4mlfd_: 4mlf D: [228541]
   automated match to d1hrti_
   complexed with act, na, nag; mutant

Details for d4mlfd_

PDB Entry: 4mlf, 2.2 Å

PDB Description: crystal structure for the complex of thrombin mutant d102n and hirudin

PDB Compounds: (D:) hirudin variant-1

SCOPe Domain Sequences for d4mlfd_:

Sequence, based on SEQRES records:

>d4mlfd_ g.3.15.2 (D:) Hirudin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpkpqshndgdfeeip
eeylq

Sequence, based on observed residues (ATOM records):

>d4mlfd_ g.3.15.2 (D:) Hirudin {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]}
vvytdctesgqnlclcegsnvcgqgnkcilgknqcvtgegtpkpqshndgdfeeipeeyl
q

Timeline for d4mlfd_:

• d4mlfd_ first appeared in SCOPe 2.03
  
• d4mlfd_ appears in SCOPe 2.06
  
• d4mlfd_ appears in the current release, SCOPe 2.08