Lineage for d4m63e2 (4m63 E:147-374)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1857402Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1857787Protein automated matches [226905] (12 species)
    not a true protein
  7. 1857805Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225128] (12 PDB entries)
  8. 1857832Domain d4m63e2: 4m63 E:147-374 [228525]
    Other proteins in same PDB: d4m63c1, d4m63d1, d4m63e1
    automated match to d2btfa2
    complexed with atp, ca

Details for d4m63e2

PDB Entry: 4m63 (more details), 2.75 Å

PDB Description: crystal structure of a filament-like actin trimer bound to the bacterial effector vopl
PDB Compounds: (E:) Actin-5C

SCOPe Domain Sequences for d4m63e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m63e2 c.55.1.1 (E:147-374) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
rttgivldsgdgvshtvpiyegyalphailrldlagrdltdylmkiltergysftttaer
eivrdikeklcyvaldfeqemataassssleksyelpdgqvitignerfrcpealfqpsf
lgmeacgihettynsimkcaaairkdlyantvlsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwiskqeydesgpsivhrkc

SCOPe Domain Coordinates for d4m63e2:

Click to download the PDB-style file with coordinates for d4m63e2.
(The format of our PDB-style files is described here.)

Timeline for d4m63e2: