Lineage for d1pnda_ (1pnd A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114377Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1114706Protein Plastocyanin [49507] (16 species)
  7. 1114754Species Poplar (Populus nigra), variant italica [TaxId:3691] [49508] (12 PDB entries)
  8. 1114759Domain d1pnda_: 1pnd A: [22848]
    complexed with cu

Details for d1pnda_

PDB Entry: 1pnd (more details), 1.6 Å

PDB Description: accuracy and precision in protein crystal structure analysis: two independent refinements of the structure of poplar plastocyanin at 173k
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d1pnda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pnda_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]}
idvllgaddgslafvpsefsispgekivfknnagfphnivfdedsipsgvdaskismsee
dllnakgetfevalsnkgeysfycsphqgagmvgkvtvn

SCOPe Domain Coordinates for d1pnda_:

Click to download the PDB-style file with coordinates for d1pnda_.
(The format of our PDB-style files is described here.)

Timeline for d1pnda_: