SCOPe 2.08: Domain d4ilfa1: 4ilf A:2-60

Lineage for d4ilfa1 (4ilf A:2-60)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families)

5. Family d.17.3.0: automated matches [228319] (1 protein)
   not a true family

6. Protein automated matches [228320] (3 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [228321] (2 PDB entries)

8. Domain d4ilfa1: 4ilf A:2-60 [228328]
   Other proteins in same PDB: d4ilfa2, d4ilfa3, d4ilfb2, d4ilfb3
   automated match to d1eeja2

Details for d4ilfa1

PDB Entry: 4ilf, 2 Å

PDB Description: crystal structure of dsbc r125a from salmonella enterica serovar typhimurium

PDB Compounds: (A:) thiol:disulfide interchange protein dsbc

SCOPe Domain Sequences for d4ilfa1:

Sequence; same for both SEQRES and ATOM records:

>d4ilfa1 d.17.3.0 (A:2-60) automated matches {Salmonella typhimurium [TaxId: 99287]}
daairqslaklgvqsteiqaspvagmktvlthsgvlyvtddgkhiiqgpmydvsgahpv

Timeline for d4ilfa1:

• d4ilfa1 first appeared in SCOPe 2.03
  
• d4ilfa1 appears in SCOPe 2.07