| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins) elaborated common fold |
| Protein automated matches [228323] (3 species) not a true protein |
| Species Salmonella typhimurium [TaxId:99287] [228324] (2 PDB entries) |
| Domain d4ilfa2: 4ilf A:61-213 [228329] Other proteins in same PDB: d4ilfa1, d4ilfa3, d4ilfb1, d4ilfb3 automated match to d1eeja1 |
PDB Entry: 4ilf (more details), 2 Å
SCOPe Domain Sequences for d4ilfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ilfa2 c.47.1.9 (A:61-213) automated matches {Salmonella typhimurium [TaxId: 99287]}
nvtnkllmsqlnalekemivykapdekhvitvftditcgychklheemkdynalgitvry
lafpaqglesqaeqdmksiwcakdknkafddamagkgvkpascdvniadhyalgvqlgvs
gtpaivlsngyvvpgyqgpkemkafldehqkqt
Timeline for d4ilfa2: