![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
![]() | Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) ![]() |
![]() | Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
![]() | Protein automated matches [226870] (22 species) not a true protein |
![]() | Species Brucella abortus [TaxId:235] [228298] (4 PDB entries) |
![]() | Domain d4e0fa2: 4e0f A:97-200 [228300] Other proteins in same PDB: d4e0fb3 automated match to d1kzla2 complexed with rbf |
PDB Entry: 4e0f (more details), 2.85 Å
SCOPe Domain Sequences for d4e0fa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4e0fa2 b.43.4.0 (A:97-200) automated matches {Brucella abortus [TaxId: 235]} emgghlvfghvdgqaeiverkdegdavrftlrapeelapfiaqkgsvaldgtsltvngvn anefdvllirhslevttwgerkagdkvnieidqlaryaarlaqy
Timeline for d4e0fa2: