Lineage for d4e0fa2 (4e0f A:97-200)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2402482Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2403031Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) (S)
  5. 2403245Family b.43.4.0: automated matches [227162] (1 protein)
    not a true family
  6. 2403246Protein automated matches [226870] (22 species)
    not a true protein
  7. 2403254Species Brucella abortus [TaxId:235] [228298] (4 PDB entries)
  8. 2403274Domain d4e0fa2: 4e0f A:97-200 [228300]
    Other proteins in same PDB: d4e0fb3
    automated match to d1kzla2
    complexed with rbf

Details for d4e0fa2

PDB Entry: 4e0f (more details), 2.85 Å

PDB Description: Crystallographic structure of trimeric Riboflavin Synthase from Brucella abortus in complex with riboflavin
PDB Compounds: (A:) Riboflavin synthase subunit alpha

SCOPe Domain Sequences for d4e0fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4e0fa2 b.43.4.0 (A:97-200) automated matches {Brucella abortus [TaxId: 235]}
emgghlvfghvdgqaeiverkdegdavrftlrapeelapfiaqkgsvaldgtsltvngvn
anefdvllirhslevttwgerkagdkvnieidqlaryaarlaqy

SCOPe Domain Coordinates for d4e0fa2:

Click to download the PDB-style file with coordinates for d4e0fa2.
(The format of our PDB-style files is described here.)

Timeline for d4e0fa2: