SCOPe 2.02: Domain d1eobb_: 1eob B:

Lineage for d1eobb_ (1eob B:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)

7. Species Acinetobacter calcoaceticus, adp1 [TaxId:471] [49491] (13 PDB entries)

8. Domain d1eobb_: 1eob B: [22829]
   Other proteins in same PDB: d1eoba_
   complexed with dhb, fe

Details for d1eobb_

PDB Entry: 1eob, 2.2 Å

PDB Description: crystal structure of acinetobacter sp. adp1 protocatechuate 3,4- dioxygenase in complex with 3,4-dihydroxybenzoate

PDB Compounds: (B:) protocatechuate 3,4-dioxygenase beta chain

SCOPe Domain Sequences for d1eobb_:

Sequence; same for both SEQRES and ATOM records:

>d1eobb_ b.3.6.1 (B:) Protocatechuate-3,4-dioxygenase, beta chain {Acinetobacter calcoaceticus, adp1 [TaxId: 471]}
iiwgayaqrntedhppayapgyktsvlrspknalisiaetlsevtaphfsadkfgpkdnd
lilnyakdglpigervivhgyvrdqfgrpvknalvevwqanasgryrhpndqyigamdpn
fggcgrmltddngyyvfrtikpgpypwrnrinewrpahihfsliadgwaqrlisqfyfeg
dtlidscpilktipseqqrralialedksnfieadsrcyrfditlrgrratyfendlt

Timeline for d1eobb_:

• d1eobb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eobb_ appears in SCOPe 2.01
  
• d1eobb_ appears in SCOPe 2.03
  
• d1eobb_ appears in the current release, SCOPe 2.08