SCOPe 2.05: Domain d4mllc_: 4mll C:

Lineage for d4mllc_ (4mll C:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein Class D beta-lactamase [56622] (4 species)

7. Species Escherichia coli, OXA-1 [TaxId:562] [82837] (3 PDB entries)

8. Domain d4mllc_: 4mll C: [228265]
   automated match to d4f7yb_
   complexed with 1s6, mpd, po4

Details for d4mllc_

PDB Entry: 4mll, 1.37 Å

PDB Description: The 1.4 A structure of the class D beta-lactamase OXA-1 K70D complexed with oxacillin

PDB Compounds: (C:) beta-lactamase OXA-1

SCOPe Domain Sequences for d4mllc_:

Sequence; same for both SEQRES and ATOM records:

>d4mllc_ e.3.1.1 (C:) Class D beta-lactamase {Escherichia coli, OXA-1 [TaxId: 562]}
stdistvasplfegtegcfllydastnaeiaqfnkakcatqmapdstfdialslmafdae
iidqktifkwdktpkgmeiwnsnhtpktwmqfsvvwvsqeitqkiglnkiknylkdfdyg
nqdfsgdkernnglteawlesslkispeeqiqflrkiinhnlpvknsaientienmylqd
ldnstklygktgagftanrtlqngwfegfiisksghkyvfvsaltgnlgsnltssikakk
naitilntlnl

Timeline for d4mllc_:

• d4mllc_ first appeared in SCOPe 2.03
  
• d4mllc_ appears in SCOPe 2.04
  
• d4mllc_ appears in SCOPe 2.06
  
• d4mllc_ appears in the current release, SCOPe 2.08