![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds) |
![]() | Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
![]() | Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) ![]() |
![]() | Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
![]() | Protein Class D beta-lactamase [56622] (4 species) |
![]() | Species Escherichia coli, OXA-1 [TaxId:562] [82837] (4 PDB entries) |
![]() | Domain d4mlld_: 4mll D: [228262] automated match to d4f7yd_ complexed with 1s6, mpd, po4 |
PDB Entry: 4mll (more details), 1.37 Å
SCOPe Domain Sequences for d4mlld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mlld_ e.3.1.1 (D:) Class D beta-lactamase {Escherichia coli, OXA-1 [TaxId: 562]} tdistvasplfegtegcfllydastnaeiaqfnkakcatqmapdstfdialslmafdaei idqktifkwdktpkgmeiwnsnhtpktwmqfsvvwvsqeitqkiglnkiknylkdfdygn qdfsgdkernnglteawlesslkispeeqiqflrkiinhnlpvknsaientienmylqdl dnstklygktgagftanrtlqngwfegfiisksghkyvfvsaltgnlgsnltssikakkn aitilntlnl
Timeline for d4mlld_: