Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family) automatically mapped to Pfam PF05194 |
Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (2 proteins) |
Protein automated matches [228225] (1 species) not a true protein |
Species Sporosarcina pasteurii [TaxId:1474] [228226] (1 PDB entry) |
Domain d4l3kb2: 4l3k B:75-141 [228227] Other proteins in same PDB: d4l3ka1, d4l3kb1 automated match to d1eara2 complexed with ni, zn |
PDB Entry: 4l3k (more details), 1.88 Å
SCOPe Domain Sequences for d4l3kb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l3kb2 d.58.38.1 (B:75-141) automated matches {Sporosarcina pasteurii [TaxId: 1474]} lekvyvikpqtmqemgkmafeignrhtmciieddeilvrydktleklidevgvsyeqser rfkepfk
Timeline for d4l3kb2: