SCOPe 2.03: Domain d4l3kb2: 4l3k B:75-141

Lineage for d4l3kb2 (4l3k B:75-141)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family)
   automatically mapped to Pfam PF05194

5. Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (2 proteins)

6. Protein automated matches [228225] (1 species)
   not a true protein

7. Species Sporosarcina pasteurii [TaxId:1474] [228226] (1 PDB entry)

8. Domain d4l3kb2: 4l3k B:75-141 [228227]
   Other proteins in same PDB: d4l3ka1, d4l3kb1
   automated match to d1eara2
   complexed with ni, zn

Details for d4l3kb2

PDB Entry: 4l3k, 1.88 Å

PDB Description: crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+

PDB Compounds: (B:) urease accessory protein uree

SCOPe Domain Sequences for d4l3kb2:

Sequence; same for both SEQRES and ATOM records:

>d4l3kb2 d.58.38.1 (B:75-141) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
lekvyvikpqtmqemgkmafeignrhtmciieddeilvrydktleklidevgvsyeqser
rfkepfk

Timeline for d4l3kb2:

• d4l3kb2 is new in SCOPe 2.03-stable
  
• d4l3kb2 appears in SCOPe 2.04
  
• d4l3kb2 appears in the current release, SCOPe 2.08