Lineage for d4l3kb2 (4l3k B:75-141)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955568Superfamily d.58.38: Urease metallochaperone UreE, C-terminal domain [69737] (1 family) (S)
    automatically mapped to Pfam PF05194
  5. 2955569Family d.58.38.1: Urease metallochaperone UreE, C-terminal domain [69738] (2 proteins)
  6. 2955585Protein automated matches [228225] (1 species)
    not a true protein
  7. 2955586Species Sporosarcina pasteurii [TaxId:1474] [228226] (1 PDB entry)
  8. 2955588Domain d4l3kb2: 4l3k B:75-141 [228227]
    Other proteins in same PDB: d4l3ka1, d4l3kb1
    automated match to d1eara2
    complexed with ni, zn

Details for d4l3kb2

PDB Entry: 4l3k (more details), 1.88 Å

PDB Description: crystal structure of sporosarcina pasteurii uree bound to ni2+ and zn2+
PDB Compounds: (B:) urease accessory protein uree

SCOPe Domain Sequences for d4l3kb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l3kb2 d.58.38.1 (B:75-141) automated matches {Sporosarcina pasteurii [TaxId: 1474]}
lekvyvikpqtmqemgkmafeignrhtmciieddeilvrydktleklidevgvsyeqser
rfkepfk

SCOPe Domain Coordinates for d4l3kb2:

Click to download the PDB-style file with coordinates for d4l3kb2.
(The format of our PDB-style files is described here.)

Timeline for d4l3kb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4l3kb1