Lineage for d4jf4b_ (4jf4 B:)

  1. Root: SCOPe 2.04
  2. 1689992Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1690252Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1690253Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1691199Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 1691200Protein automated matches [190857] (19 species)
    not a true protein
  7. 1691201Species Acinetobacter baumannii [TaxId:470] [194613] (22 PDB entries)
  8. 1691220Domain d4jf4b_: 4jf4 B: [228198]
    automated match to d4k0xa_
    complexed with edo, mer

Details for d4jf4b_

PDB Entry: 4jf4 (more details), 2.14 Å

PDB Description: OXA-23 meropenem complex
PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d4jf4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jf4b_ e.3.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
vqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfkmlnaliglen
qktdineifkwkgekrsftawekdmtlgeamklsavpvyqelarrigldlmqkevkrigf
gnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesngyk
ifgktgwamdikpqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkqlni
i

SCOPe Domain Coordinates for d4jf4b_:

Click to download the PDB-style file with coordinates for d4jf4b_.
(The format of our PDB-style files is described here.)

Timeline for d4jf4b_: