Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.0: automated matches [191512] (1 protein) not a true family |
Protein automated matches [190857] (31 species) not a true protein |
Species Acinetobacter baumannii [TaxId:470] [194613] (31 PDB entries) |
Domain d4jf4a_: 4jf4 A: [228196] automated match to d4k0xa_ complexed with edo, mer |
PDB Entry: 4jf4 (more details), 2.14 Å
SCOPe Domain Sequences for d4jf4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jf4a_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]} ivqghnqvihqyfdekntsgvlviqtdkkinlygnalsranteyvpastfkmlnaligle nqktdineifkwkgekrsftawekdmtlgeamklsavpvyqelarrigldlmqkevkrig fgnaeigqqvdnfwlvgplkvtpiqevefvsqlahtqlpfsekvqanvknmllleesngy kifgktgwamdikpqvgwltgwveqpdgkivafalnmemrsempasirnellmkslkqln ii
Timeline for d4jf4a_: