SCOPe 2.05: Domain d4keva_: 4kev A:

Lineage for d4keva_ (4kev A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (22 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:2287] [188418] (10 PDB entries)

8. Domain d4keva_: 4kev A: [228064]
   automated match to d2vc7a_
   complexed with co, fe2

Details for d4keva_

PDB Entry: 4kev, 2.65 Å

PDB Description: Crystal structure of SsoPox W263L

PDB Compounds: (A:) aryldialkylphosphatase

SCOPe Domain Sequences for d4keva_:

Sequence; same for both SEQRES and ATOM records:

>d4keva_ c.1.9.0 (A:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
mriplvgkdsieskdigftlihehlrvfseavrqqwphlynedeefrnavnevkramqfg
vktivdptvmglgrdirfmekvvkatginlvagtgiyiyidlpfyflnrsideiadlfih
dikegiqgtlnkagfvkiaadepgitkdvekviraaaianketkvpiithsnahnntgle
qqrilteegvdpgkilighlgdtdnidyikkiadkgsfigldrygldlflpvdkrnettl
rlikdgysdkimishdycctidlgtakpeykpklaprwsitlifedtipflkrngvneev
iatifkenpkkffs

Timeline for d4keva_:

• d4keva_ first appeared in SCOPe 2.03
  
• d4keva_ appears in SCOPe 2.04
  
• d4keva_ appears in SCOPe 2.06
  
• d4keva_ appears in the current release, SCOPe 2.08