Lineage for d3pcfm_ (3pcf M:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1113318Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1113967Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 1113968Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1114150Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 1114165Species Pseudomonas putida [TaxId:303] [49490] (31 PDB entries)
  8. 1114280Domain d3pcfm_: 3pcf M: [22802]
    Other proteins in same PDB: d3pcfa_, d3pcfb_, d3pcfc_, d3pcfd_, d3pcfe_, d3pcff_
    complexed with bme, fe, fhb

Details for d3pcfm_

PDB Entry: 3pcf (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3-fluro-4- hydroxybenzoate
PDB Compounds: (M:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcfm_:

Sequence, based on SEQRES records: (download)

>d3pcfm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pcfm_ b.3.6.1 (M:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d3pcfm_:

Click to download the PDB-style file with coordinates for d3pcfm_.
(The format of our PDB-style files is described here.)

Timeline for d3pcfm_: