SCOPe 2.08: Domain d4hwtb2: 4hwt B:645-755

Lineage for d4hwtb2 (4hwt B:645-755)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families)

5. Family c.51.1.0: automated matches [227929] (1 protein)
   not a true family

6. Protein automated matches [227930] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [227931] (3 PDB entries)

8. Domain d4hwtb2: 4hwt B:645-755 [227934]
   Other proteins in same PDB: d4hwta1, d4hwtb1
   automated match to d1qf6a1
   protein/RNA complex; complexed with 1b2, zn

Details for d4hwtb2

PDB Entry: 4hwt, 2.3 Å

PDB Description: Crystal structure of human Threonyl-tRNA synthetase bound to a novel inhibitor

PDB Compounds: (B:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4hwtb2:

Sequence; same for both SEQRES and ATOM records:

>d4hwtb2 c.51.1.0 (B:645-755) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wpfwlsprqvmvvpvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqyn
filvvgekekisgtvnirtrdnkvhgertisetierlqqlkefrskqaeee

Timeline for d4hwtb2:

• d4hwtb2 first appeared in SCOPe 2.03
  
• d4hwtb2 appears in SCOPe 2.07