![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.0: automated matches [227172] (1 protein) not a true family |
![]() | Protein automated matches [226887] (24 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries) |
![]() | Domain d4hwtb1: 4hwt B:354-644 [227933] Other proteins in same PDB: d4hwta2, d4hwtb2 automated match to d1qf6a4 protein/RNA complex; complexed with 1b2, zn |
PDB Entry: 4hwt (more details), 2.3 Å
SCOPe Domain Sequences for d4hwtb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hwtb1 d.104.1.0 (B:354-644) automated matches {Human (Homo sapiens) [TaxId: 9606]} rdhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifns rlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvl hrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlst rpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcat iqldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk
Timeline for d4hwtb1: