Lineage for d4hwtb1 (4hwt B:354-644)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968077Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)
  8. 2968081Domain d4hwtb1: 4hwt B:354-644 [227933]
    Other proteins in same PDB: d4hwta2, d4hwtb2
    automated match to d1qf6a4
    protein/RNA complex; complexed with 1b2, zn

Details for d4hwtb1

PDB Entry: 4hwt (more details), 2.3 Å

PDB Description: Crystal structure of human Threonyl-tRNA synthetase bound to a novel inhibitor
PDB Compounds: (B:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4hwtb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hwtb1 d.104.1.0 (B:354-644) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rdhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifns
rlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvl
hrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlst
rpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcat
iqldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk

SCOPe Domain Coordinates for d4hwtb1:

Click to download the PDB-style file with coordinates for d4hwtb1.
(The format of our PDB-style files is described here.)

Timeline for d4hwtb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hwtb2