Lineage for d4llab2 (4lla B:100-201)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2368004Domain d4llab2: 4lla B:100-201 [227904]
    automated match to d2dlia2

Details for d4llab2

PDB Entry: 4lla (more details), 2.5 Å

PDB Description: Crystal structure of D3D4 domain of the LILRB2 molecule
PDB Compounds: (B:) Leukocyte immunoglobulin-like receptor subfamily B member 2

SCOPe Domain Sequences for d4llab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4llab2 b.1.1.0 (B:100-201) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgqirgtpfisvqpgptvasgenvtllcqswrqfhtflltkagaadaplrlrsiheypky
qaefpmspvtsahagtyrcygslnsdpyllshpseplelvvs

SCOPe Domain Coordinates for d4llab2:

Click to download the PDB-style file with coordinates for d4llab2.
(The format of our PDB-style files is described here.)

Timeline for d4llab2: