SCOPe 2.08: Domain d4m49c2: 4m49 C:160-331

Lineage for d4m49c2 (4m49 C:160-331)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein Lactate dehydrogenase [56339] (20 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (39 PDB entries)

8. Domain d4m49c2: 4m49 C:160-331 [227782]
   Other proteins in same PDB: d4m49a1, d4m49b1, d4m49c1, d4m49d1
   automated match to d1i10a2
   complexed with 22y, epe, lac, nai, so4

Details for d4m49c2

PDB Entry: 4m49, 2.05 Å

PDB Description: Lactate Dehydrogenase A in complex with a substituted pyrazine inhibitor compound 18

PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4m49c2:

Sequence; same for both SEQRES and ATOM records:

>d4m49c2 d.162.1.1 (C:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

Timeline for d4m49c2:

• d4m49c2 first appeared in SCOPe 2.03
  
• d4m49c2 appears in SCOPe 2.07