Lineage for d4m49c2 (4m49 C:160-331)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2556797Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2556804Protein Lactate dehydrogenase [56339] (20 species)
  7. 2556875Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (23 PDB entries)
  8. 2556882Domain d4m49c2: 4m49 C:160-331 [227782]
    Other proteins in same PDB: d4m49a1, d4m49b1, d4m49c1, d4m49d1
    automated match to d1i10a2
    complexed with 22y, epe, lac, nai, so4

Details for d4m49c2

PDB Entry: 4m49 (more details), 2.05 Å

PDB Description: Lactate Dehydrogenase A in complex with a substituted pyrazine inhibitor compound 18
PDB Compounds: (C:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4m49c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m49c2 d.162.1.1 (C:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d4m49c2:

Click to download the PDB-style file with coordinates for d4m49c2.
(The format of our PDB-style files is described here.)

Timeline for d4m49c2: