Lineage for d3pcar_ (3pca R:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939770Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 939771Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 939951Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 939966Species Pseudomonas putida [TaxId:303] [49490] (29 PDB entries)
  8. 940074Domain d3pcar_: 3pca R: [22771]
    Other proteins in same PDB: d3pcaa_, d3pcab_, d3pcac_, d3pcad_, d3pcae_, d3pcaf_
    complexed with bme, dhb, fe

Details for d3pcar_

PDB Entry: 3pca (more details), 2.2 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 3,4-dihydroxybenzoate
PDB Compounds: (R:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcar_:

Sequence, based on SEQRES records: (download)

>d3pcar_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pcar_ b.3.6.1 (R:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d3pcar_:

Click to download the PDB-style file with coordinates for d3pcar_.
(The format of our PDB-style files is described here.)

Timeline for d3pcar_: