| Class g: Small proteins [56992] (92 folds) |
| Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) ![]() |
| Family g.3.11.1: EGF-type module [57197] (23 proteins) |
| Protein Coagulation factor VIIa [57201] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [57202] (56 PDB entries) Uniprot P08709 108-202 ! Uniprot P08709 107-202 |
| Domain d4jzfl_: 4jzf L: [227607] Other proteins in same PDB: d4jzfh_ automated match to d1w7xl_ complexed with 1nl, ca, gol, so4 |
PDB Entry: 4jzf (more details), 1.84 Å
SCOPe Domain Sequences for d4jzfl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4jzfl_ g.3.11.1 (L:) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]}
icvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipilekr
Timeline for d4jzfl_: