Lineage for d4g5ya_ (4g5y A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590547Family c.26.1.4: Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63976] (2 proteins)
    contains C-terminal subdomain similar to one structural repeat of the Creatinase/aminopeptidase family
    automatically mapped to Pfam PF02569
  6. 1590548Protein Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) [63977] (5 species)
  7. 1590552Species Mycobacterium tuberculosis [TaxId:1773] [89615] (48 PDB entries)
  8. 1590594Domain d4g5ya_: 4g5y A: [227497]
    automated match to d3coya_
    complexed with 0oc, atp, eoh, gol, mg

Details for d4g5ya_

PDB Entry: 4g5y (more details), 1.8 Å

PDB Description: crystal structure of mycobacterium tuberculosis pantothenate synthetase in a ternary complex with atp and n,n-dimethylthiophene-3- sulfonamide
PDB Compounds: (A:) Pantothenate synthetase

SCOPe Domain Sequences for d4g5ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4g5ya_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]}
pafhpgelnvysapgdvadvsralrltgrrvmlvptmgalheghlalvraakrvpgsvvv
vsifvnpmqfgaggdldayprtpdddlaqlraegveiaftpttaamypdglrttvqpgpl
aaeleggprpthfagvltvvlkllqivrpdrvffgekdyqqlvlirqlvadfnldvavvg
vptvreadglamssrnryldpaqraaavalsaaltaaahaatagaqaaldaaravldaap
gvavdylelrdiglgpmplngsgrllvaarlgttrlldniaieigt

SCOPe Domain Coordinates for d4g5ya_:

Click to download the PDB-style file with coordinates for d4g5ya_.
(The format of our PDB-style files is described here.)

Timeline for d4g5ya_: