Lineage for d3pcgn_ (3pcg N:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939770Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 939771Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 939951Protein Protocatechuate-3,4-dioxygenase, beta chain [49489] (2 species)
  7. 939966Species Pseudomonas putida [TaxId:303] [49490] (29 PDB entries)
  8. 940001Domain d3pcgn_: 3pcg N: [22743]
    Other proteins in same PDB: d3pcga_, d3pcgb_, d3pcgc_, d3pcgd_, d3pcge_, d3pcgf_
    complexed with 4hp, bme, fe

Details for d3pcgn_

PDB Entry: 3pcg (more details), 1.96 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with the inhibitor 4-hydroxyphenylacetate
PDB Compounds: (N:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcgn_:

Sequence, based on SEQRES records: (download)

>d3pcgn_ b.3.6.1 (N:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfnngglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapld
pnfggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyf
egdplipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

Sequence, based on observed residues (ATOM records): (download)

>d3pcgn_ b.3.6.1 (N:) Protocatechuate-3,4-dioxygenase, beta chain {Pseudomonas putida [TaxId: 303]}
paqdnsrfvirdrnwhpkaltpdyktsiarsprqalvsipqsisettgpnfshlgfgahd
hdlllnfglpigeriivagrvvdqygkpvpntlvemwqanaggryrhkndrylapldpnf
ggvgrcltdsdgyysfrtikpgpypwrngpndwrpahihfgisgpsiatklitqlyfegd
plipmcpivksianpeavqqliakldmnnanpmdclayrfdivlrgqrkthfe

SCOPe Domain Coordinates for d3pcgn_:

Click to download the PDB-style file with coordinates for d3pcgn_.
(The format of our PDB-style files is described here.)

Timeline for d3pcgn_: