SCOPe 2.06: Domain d3ugja5: 3ugj A:617-816

Lineage for d3ugja5 (3ugj A:617-816)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families)

5. Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)

6. Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (3 species)

7. Species Salmonella enterica [TaxId:90371] [227351] (2 PDB entries)

8. Domain d3ugja5: 3ugj A:617-816 [227363]
   Other proteins in same PDB: d3ugja1, d3ugja2, d3ugja4, d3ugja6, d3ugja7, d3ugja8
   automated match to d1t3ta5
   complexed with adp, mg, so4

Details for d3ugja5

PDB Entry: 3ugj, 1.78 Å

PDB Description: formyl glycinamide ribonucletide amidotransferase from salmonella typhimurum: role of the atp complexation and glutaminase domain in catalytic coupling

PDB Compounds: (A:) Phosphoribosylformylglycinamidine synthase

SCOPe Domain Sequences for d3ugja5:

Sequence, based on SEQRES records:

>d3ugja5 d.79.4.1 (A:617-816) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella enterica [TaxId: 90371]}
qtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmvgpwqvp
vadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigdikrikl
sanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegneqremts
plslvisafarvedvrhtlt

Sequence, based on observed residues (ATOM records):

>d3ugja5 d.79.4.1 (A:617-816) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella enterica [TaxId: 90371]}
qtlkakgdalnraditiadavkrvlhlptvaektflvtigdrtvtgmvardqmvgpwqvp
vadcavttasldsyygeamsigerapvalldfaasarlavgealtniaatqigdikrikl
sanwmaaaghpgedaglydavkavgeelcpqlgltipvgkdsmsmktrwqegqremtspl
slvisafarvedvrhtlt

Timeline for d3ugja5:

• d3ugja5 first appeared in SCOPe 2.03
  
• d3ugja5 appears in SCOPe 2.05
  
• d3ugja5 appears in SCOPe 2.07
  
• d3ugja5 appears in the current release, SCOPe 2.08