SCOPe 2.08: Domain d2v2ua1: 2v2u A:1-85

Lineage for d2v2ua1 (2v2u A:1-85)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226633] (2 PDB entries)

8. Domain d2v2ua1: 2v2u A:1-85 [227312]
   automated match to d1elpa1

Details for d2v2ua1

PDB Entry: 2v2u, 1.9 Å

PDB Description: Structure of Mouse gammaC-crystallin

PDB Compounds: (A:) gamma crystallin c

SCOPe Domain Sequences for d2v2ua1:

Sequence; same for both SEQRES and ATOM records:

>d2v2ua1 b.11.1.0 (A:1-85) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gkitffedrsfqgrcyecssdcpnlqtyfsrcnsvrvdsgcwmlyerpnyqghqyflrrg
eypdyqqwmgfsdsirscrliphag

Timeline for d2v2ua1:

• d2v2ua1 first appeared in SCOPe 2.03
  
• d2v2ua1 appears in SCOPe 2.07