Lineage for d2v2ua1 (2v2u A:1-85)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773700Species Mouse (Mus musculus) [TaxId:10090] [226633] (2 PDB entries)
  8. 2773703Domain d2v2ua1: 2v2u A:1-85 [227312]
    automated match to d1elpa1

Details for d2v2ua1

PDB Entry: 2v2u (more details), 1.9 Å

PDB Description: Structure of Mouse gammaC-crystallin
PDB Compounds: (A:) gamma crystallin c

SCOPe Domain Sequences for d2v2ua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v2ua1 b.11.1.0 (A:1-85) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gkitffedrsfqgrcyecssdcpnlqtyfsrcnsvrvdsgcwmlyerpnyqghqyflrrg
eypdyqqwmgfsdsirscrliphag

SCOPe Domain Coordinates for d2v2ua1:

Click to download the PDB-style file with coordinates for d2v2ua1.
(The format of our PDB-style files is described here.)

Timeline for d2v2ua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2v2ua2