SCOPe 2.08: Domain d2v2ub2: 2v2u B:86-173

Lineage for d2v2ub2 (2v2u B:86-173)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.0: automated matches [191607] (1 protein)
   not a true family

6. Protein automated matches [191109] (11 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [226633] (2 PDB entries)

8. Domain d2v2ub2: 2v2u B:86-173 [227313]
   automated match to d1elpa2

Details for d2v2ub2

PDB Entry: 2v2u, 1.9 Å

PDB Description: Structure of Mouse gammaC-crystallin

PDB Compounds: (B:) gamma crystallin c

SCOPe Domain Sequences for d2v2ub2:

Sequence; same for both SEQRES and ATOM records:

>d2v2ub2 b.11.1.0 (B:86-173) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
shrmrlyekedhkgvmmelsedcsciqdrfhlsevrslqvlegcwvlyempnyrgrqyll
rpqeyrrfqdwgsvdakagslrrvvdly

Timeline for d2v2ub2:

• d2v2ub2 first appeared in SCOPe 2.03
  
• d2v2ub2 appears in SCOPe 2.07