![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) ![]() |
![]() | Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins) sandwich; 9 strands in 2 sheets |
![]() | Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species) alpha and beta chains are derived from a single-chain protomer and share this fold |
![]() | Species Pseudomonas putida [TaxId:303] [49487] (31 PDB entries) |
![]() | Domain d3pcmc_: 3pcm C: [22721] Other proteins in same PDB: d3pcmm_, d3pcmn_, d3pcmo_, d3pcmp_, d3pcmq_, d3pcmr_ complexed with cyn, fe, nno |
PDB Entry: 3pcm (more details), 2.25 Å
SCOPe Domain Sequences for d3pcmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pcmc_ b.3.6.1 (C:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]} piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk tayrfdiriqgegetvffdf
Timeline for d3pcmc_: