Lineage for d3pcma_ (3pcm A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1301408Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1302191Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families) (S)
  5. 1302192Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 1302215Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 1302223Species Pseudomonas putida [TaxId:303] [49487] (31 PDB entries)
  8. 1302362Domain d3pcma_: 3pcm A: [22719]
    Other proteins in same PDB: d3pcmm_, d3pcmn_, d3pcmo_, d3pcmp_, d3pcmq_, d3pcmr_
    complexed with cyn, fe, nno

Details for d3pcma_

PDB Entry: 3pcm (more details), 2.25 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 6-hydroxynicotinic acid n-oxide and cyanide
PDB Compounds: (A:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pcma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pcma_ b.3.6.1 (A:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3pcma_:

Click to download the PDB-style file with coordinates for d3pcma_.
(The format of our PDB-style files is described here.)

Timeline for d3pcma_: