Lineage for d3pclf_ (3pcl F:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 939143Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 939770Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 939771Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
    sandwich; 9 strands in 2 sheets
  6. 939786Protein Protocatechuate-3,4-dioxygenase, alpha chain [49486] (2 species)
    alpha and beta chains are derived from a single-chain protomer and share this fold
  7. 939794Species Pseudomonas putida [TaxId:303] [49487] (29 PDB entries)
  8. 939914Domain d3pclf_: 3pcl F: [22718]
    Other proteins in same PDB: d3pclm_, d3pcln_, d3pclo_, d3pclp_, d3pclq_, d3pclr_
    complexed with cyn, fe, ino

Details for d3pclf_

PDB Entry: 3pcl (more details), 2.15 Å

PDB Description: structure of protocatechuate 3,4-dioxygenase complexed with 2-hydroxyisonicotinic acid n-oxide and cyanide
PDB Compounds: (F:) protocatechuate 3,4-dioxygenase

SCOPe Domain Sequences for d3pclf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pclf_ b.3.6.1 (F:) Protocatechuate-3,4-dioxygenase, alpha chain {Pseudomonas putida [TaxId: 303]}
piellpetpsqtagpyvhiglaleaagnptrdqeiwnrlakpdapgehilllgqvydgng
hlvrdsflevwqadangeyqdaynlenafnsfgrtattfdagewtlhtvkpgvvnnaagv
pmaphinislfarginihlhtrlyfddeaqanakcpvlnlieqpqrretliakrcevdgk
tayrfdiriqgegetvffdf

SCOPe Domain Coordinates for d3pclf_:

Click to download the PDB-style file with coordinates for d3pclf_.
(The format of our PDB-style files is described here.)

Timeline for d3pclf_: