Lineage for d1dltb_ (1dlt B:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 790366Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 790808Superfamily b.3.6: Aromatic compound dioxygenase [49482] (1 family) (S)
  5. 790809Family b.3.6.1: Aromatic compound dioxygenase [49483] (4 proteins)
    sandwich; 9 strands in 2 sheets
  6. 790810Protein Catechol 1,2-dioxygenase [49484] (1 species)
    contains alpha-helical dimerization subdomain at the N-terminus
  7. 790811Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)
  8. 790815Domain d1dltb_: 1dlt B: [22636]
    complexed with caq, fe, lio

Details for d1dltb_

PDB Entry: 1dlt (more details), 1.9 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound catechol
PDB Compounds: (B:) catechol 1,2-dioxygenase

SCOP Domain Sequences for d1dltb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dltb_ b.3.6.1 (B:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

SCOP Domain Coordinates for d1dltb_:

Click to download the PDB-style file with coordinates for d1dltb_.
(The format of our PDB-style files is described here.)

Timeline for d1dltb_: