SCOPe 2.08: Domain d1dltb_: 1dlt B:

Lineage for d1dltb_ (1dlt B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.6: Aromatic compound dioxygenase [49482] (2 families)

5. Family b.3.6.1: Aromatic compound dioxygenase [49483] (5 proteins)
   sandwich; 9 strands in 2 sheets

6. Protein Catechol 1,2-dioxygenase [49484] (1 species)
   contains alpha-helical dimerization subdomain at the N-terminus

7. Species Acinetobacter calcoaceticus [TaxId:471] [49485] (4 PDB entries)

8. Domain d1dltb_: 1dlt B: [22636]
   complexed with caq, fe, lio

Details for d1dltb_

PDB Entry: 1dlt, 1.9 Å

PDB Description: structure of catechol 1,2-dioxygenase from acinetobacter sp. adp1 with bound catechol

PDB Compounds: (B:) catechol 1,2-dioxygenase

SCOPe Domain Sequences for d1dltb_:

Sequence; same for both SEQRES and ATOM records:

>d1dltb_ b.3.6.1 (B:) Catechol 1,2-dioxygenase {Acinetobacter calcoaceticus [TaxId: 471]}
vkifntqdvqdflrvasgleqeggnprvkqiihrvlsdlykaiedlnitsdeywagvayl
nqlganqeagllspglgfdhyldmrmdaedaalgienatprtiegplyvagapesvgyar
mddgsdpnghtlilhgtifdadgkplpnakveiwhantkgfyshfdptgeqqafnmrrsi
itdengqyrvrtilpagygcppegptqqllnqlgrhgnrpahihyfvsadghrklttqin
vagdpytyddfayatreglvvdavehtdpeaikandvegpfaemvfdlkltrlvdgvdnq
vvdrprlav

Timeline for d1dltb_:

• d1dltb_ first appeared (with stable ids) in SCOP 1.55
  
• d1dltb_ appears in SCOPe 2.07