![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (6 superfamilies) |
![]() | Superfamily b.3.5: B repeat unit of collagen binding surface protein (cna) [49478] (1 family) ![]() |
![]() | Family b.3.5.1: B repeat unit of collagen binding surface protein (cna) [49479] (1 protein) |
![]() | Protein B repeat unit of collagen binding surface protein (cna) [49480] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [49481] (2 PDB entries) |
![]() | Domain d1d2pa4: 1d2p A:812-907 [22632] |
PDB Entry: 1d2p (more details), 2.5 Å
SCOP Domain Sequences for d1d2pa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d2pa4 b.3.5.1 (A:812-907) B repeat unit of collagen binding surface protein (cna) {Staphylococcus aureus} getsatvtknwddnnnqdgkrpteikvelyqdgkatgktailnesnnwthtwtgldekak gqqvkytveeltkvkgytthvdnndmgnlittnkyt
Timeline for d1d2pa4: