Lineage for d5ttrg_ (5ttr G:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162042Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 162125Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 162126Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 162127Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
  7. 162131Species Human (Homo sapiens) [TaxId:9606] [49475] (41 PDB entries)
  8. 162216Domain d5ttrg_: 5ttr G: [22609]

Details for d5ttrg_

PDB Entry: 5ttr (more details), 2.7 Å

PDB Description: leu 55 pro transthyretin crystal structure

SCOP Domain Sequences for d5ttrg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ttrg_ b.3.4.1 (G:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgephgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

SCOP Domain Coordinates for d5ttrg_:

Click to download the PDB-style file with coordinates for d5ttrg_.
(The format of our PDB-style files is described here.)

Timeline for d5ttrg_: