SCOP 1.61: Domain d1tyrb_: 1tyr B:

Lineage for d1tyrb_ (1tyr B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (41 PDB entries)

8. Domain d1tyrb_: 1tyr B: [22572]

Details for d1tyrb_

PDB Entry: 1tyr, 1.8 Å

PDB Description: transthyretin complex with retinoic acid

SCOP Domain Sequences for d1tyrb_:

Sequence; same for both SEQRES and ATOM records:

>d1tyrb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke

Timeline for d1tyrb_:

• d1tyrb_ first appeared (with stable ids) in SCOP 1.55
  
• d1tyrb_ appears in SCOP 1.59
  
• d1tyrb_ appears in SCOP 1.63
  
• d1tyrb_ appears in the current release, SCOPe 2.08