SCOP 1.61: Domain d1e3fa_: 1e3f A:

Lineage for d1e3fa_ (1e3f A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family)

5. Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)

6. Protein Transthyretin (synonym: prealbumin) [49474] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (41 PDB entries)

8. Domain d1e3fa_: 1e3f A: [22569]

Details for d1e3fa_

PDB Entry: 1e3f, 1.9 Å

PDB Description: structure of human transthyretin complexed with bromophenols: a new mode of binding

SCOP Domain Sequences for d1e3fa_:

Sequence; same for both SEQRES and ATOM records:

>d1e3fa_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d1e3fa_:

• d1e3fa_ first appeared (with stable ids) in SCOP 1.55
  
• d1e3fa_ appears in SCOP 1.59
  
• d1e3fa_ appears in SCOP 1.63
  
• d1e3fa_ appears in the current release, SCOPe 2.08