Lineage for d1eta1_ (1eta 1:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 162042Fold b.3: Prealbumin-like [49451] (6 superfamilies)
  4. 162125Superfamily b.3.4: Transthyretin (prealbumin) [49472] (1 family) (S)
  5. 162126Family b.3.4.1: Transthyretin (prealbumin) [49473] (1 protein)
  6. 162127Protein Transthyretin (synonym: prealbumin) [49474] (3 species)
  7. 162131Species Human (Homo sapiens) [TaxId:9606] [49475] (41 PDB entries)
  8. 162142Domain d1eta1_: 1eta 1: [22547]

Details for d1eta1_

PDB Entry: 1eta (more details), 1.7 Å

PDB Description: the x-ray crystal structure refinements of normal human transthyretin and the amyloidogenic val 30-->met variant to 1.7 angstroms resolution

SCOP Domain Sequences for d1eta1_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eta1_ b.3.4.1 (1:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens)}
gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
vvtnpke

SCOP Domain Coordinates for d1eta1_:

Click to download the PDB-style file with coordinates for d1eta1_.
(The format of our PDB-style files is described here.)

Timeline for d1eta1_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1eta2_