Lineage for d1vcbl_ (1vcb L:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1526161Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1526324Superfamily b.3.3: VHL [49468] (1 family) (S)
    automatically mapped to Pfam PF01847
  5. 1526325Family b.3.3.1: VHL [49469] (2 proteins)
  6. 1526326Protein VHL [49470] (1 species)
  7. 1526327Species Human (Homo sapiens) [TaxId:9606] [49471] (17 PDB entries)
  8. 1526376Domain d1vcbl_: 1vcb L: [22538]
    Other proteins in same PDB: d1vcba_, d1vcbb_, d1vcbd_, d1vcbe_, d1vcbg_, d1vcbh_, d1vcbj_, d1vcbk_

Details for d1vcbl_

PDB Entry: 1vcb (more details), 2.7 Å

PDB Description: the vhl-elonginc-elonginb structure
PDB Compounds: (L:) protein (vhl)

SCOPe Domain Sequences for d1vcbl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vcbl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]}
lrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrda
gthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldivr
slyedledhpnvqkdlerltqe

SCOPe Domain Coordinates for d1vcbl_:

Click to download the PDB-style file with coordinates for d1vcbl_.
(The format of our PDB-style files is described here.)

Timeline for d1vcbl_: