Lineage for d1acza_ (1acz A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768598Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) (S)
  5. 2768599Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
    automatically mapped to Pfam PF00686
  6. 2768701Protein Glucoamylase, granular starch-binding domain [49460] (1 species)
  7. 2768702Species Aspergillus niger [TaxId:5061] [49461] (5 PDB entries)
  8. 2768709Domain d1acza_: 1acz A: [22524]

Details for d1acza_

PDB Entry: 1acz (more details)

PDB Description: glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, 5 structures
PDB Compounds: (A:) glucoamylase

SCOPe Domain Sequences for d1acza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1acza_ b.3.1.1 (A:) Glucoamylase, granular starch-binding domain {Aspergillus niger [TaxId: 5061]}
cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr

SCOPe Domain Coordinates for d1acza_:

Click to download the PDB-style file with coordinates for d1acza_.
(The format of our PDB-style files is described here.)

Timeline for d1acza_: