PDB entry 1acz

View 1acz on RCSB PDB site
Description: glucoamylase, granular starch-binding domain complex with cyclodextrin, nmr, 5 structures
Class: polysaccharide degradation
Keywords: hydrolase, starch binding domain, glycosidase, polysaccharide degradation, glycoprotein, alternative splicing
Deposited on 1997-02-10, released 1997-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: glucoamylase
  Species: Aspergillus niger [TaxId:5061]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P04064 (0-107)
  Domains in SCOPe 2.08: d1acza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1aczA (A:)
  cttptavavtfdltatttygeniylvgsisqlgdwetsdgialsadkytssdplwyvtvt
  lpagesfeykfiriesddsvewesdpnreytvpqacgtstatvtdtwr