![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.1: Starch-binding domain-like [49452] (4 families) ![]() |
![]() | Family b.3.1.1: Starch-binding domain [49453] (3 proteins) automatically mapped to Pfam PF00686 |
![]() | Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) this domain is the last one in the protein chain |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [49456] (1 PDB entry) |
![]() | Domain d1cyga2: 1cyg A:575-680 [22512] Other proteins in same PDB: d1cyga1, d1cyga3, d1cyga4 complexed with ca |
PDB Entry: 1cyg (more details), 2.5 Å
SCOPe Domain Sequences for d1cyga2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyga2 b.3.1.1 (A:575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} ltndqvsvrfvvnnattnlgqniyivgnvyelgnwdtskaigpmfnqvvysyptwyidvs vpegktiefkfikkdsqgnvtwesgsnhvyttptnttgkiivdwqn
Timeline for d1cyga2: