Lineage for d1cyg_2 (1cyg 575-680)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.3: Prealbumin-like [49451] (6 superfamilies) 
Superfamily b.3.1: Starch-binding domain [49452] (1 family) 
Family b.3.1.1: Starch-binding domain [49453] (3 proteins) Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species) 
Species Bacillus stearothermophilus [TaxId:1422] [49456] (1 PDB entry) 
Domain d1cyg_2: 1cyg 575-680 [22512]
Other proteins in same PDB: d1cyg_1, d1cyg_3, d1cyg_4
Details for d1cyg_2
PDB Entry: 1cyg (more details), 2.5 Å
PDB Description: cyclodextrin glucanotransferase (e.c.2.4.1.19) (cgtase)
SCOP Domain Sequences for d1cyg_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cyg_2 b.3.1.1 (575-680) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus stearothermophilus}
ltndqvsvrfvvnnattnlgqniyivgnvyelgnwdtskaigpmfnqvvysyptwyidvs
vpegktiefkfikkdsqgnvtwesgsnhvyttptnttgkiivdwqn
SCOP Domain Coordinates for d1cyg_2:
Click to download the PDB-style file with coordinates for d1cyg_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cyg_2:
- d1cyg_2 appears in SCOP 1.57
- d1cyg_2 appears in the current release, SCOPe 2.08, called d1cyga2
View in 3D
