SCOP 1.61: Domain d1tcmb2: 1tcm B:582-686

Lineage for d1tcmb2 (1tcm B:582-686)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.3: Prealbumin-like [49451] (6 superfamilies)

4. Superfamily b.3.1: Starch-binding domain [49452] (1 family)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (29 PDB entries)

8. Domain d1tcmb2: 1tcm B:582-686 [22503]
   Other proteins in same PDB: d1tcma1, d1tcma3, d1tcma4, d1tcmb1, d1tcmb3, d1tcmb4

Details for d1tcmb2

PDB Entry: 1tcm, 2.2 Å

PDB Description: cyclodextrin glycosyltransferase w616a mutant from bacillus circulans strain 251

SCOP Domain Sequences for d1tcmb2:

Sequence; same for both SEQRES and ATOM records:

>d1tcmb2 b.3.1.1 (B:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnadpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1tcmb2:

• d1tcmb2 first appeared (with stable ids) in SCOP 1.55
  
• d1tcmb2 appears in SCOP 1.59
  
• d1tcmb2 appears in SCOP 1.63
  
• d1tcmb2 appears in the current release, SCOPe 2.08