SCOPe 2.07: Domain d1cxha2: 1cxh A:582-686

Lineage for d1cxha2 (1cxh A:582-686)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
   automatically mapped to Pfam PF00686

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d1cxha2: 1cxh A:582-686 [22490]
   Other proteins in same PDB: d1cxha1, d1cxha3, d1cxha4
   complexed with ca, mal

Details for d1cxha2

PDB Entry: 1cxh, 2.41 Å

PDB Description: complex of cgtase with maltotetraose at room temperature and ph 9.6 based on diffraction data of a crystal soaked with maltoheptaose

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1cxha2:

Sequence; same for both SEQRES and ATOM records:

>d1cxha2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1cxha2:

• d1cxha2 first appeared (with stable ids) in SCOP 1.55, called d1cxh_2
  
• d1cxha2 appears in SCOPe 2.06
  
• d1cxha2 appears in the current release, SCOPe 2.08