| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) ![]() |
| Family d.162.1.0: automated matches [227146] (1 protein) not a true family |
| Protein automated matches [226850] (29 species) not a true protein |
| Species Bacillus selenitireducens [TaxId:439292] [226756] (1 PDB entry) |
| Domain d4m1qb2: 4m1q B:145-315 [224816] Other proteins in same PDB: d4m1qa1, d4m1qb1 automated match to d5ldha2 complexed with mpd, po4 |
PDB Entry: 4m1q (more details), 1.6 Å
SCOPe Domain Sequences for d4m1qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4m1qb2 d.162.1.0 (B:145-315) automated matches {Bacillus selenitireducens [TaxId: 439292]}
sgtildtarfrfllseyfdidvrnihgyimgehgdtelpvwsqtrigsepisrymdkykp
dgsnkdldeifvnvrdaayhiierkgathyaiamglarltkailrneqsiltvstlmege
ydlddvyigvpaivsqkgveraieidlndeemkklhhssntlkdvmkpifd
Timeline for d4m1qb2: