Lineage for d4lyyd_ (4lyy D:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1863464Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1863465Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 1863901Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 1863902Protein automated matches [190891] (25 species)
    not a true protein
  7. 1864059Species Shewanella pealeana [TaxId:398579] [226751] (1 PDB entry)
  8. 1864063Domain d4lyyd_: 4lyy D: [224794]
    automated match to d2vfaa_
    complexed with po4

Details for d4lyyd_

PDB Entry: 4lyy (more details), 1.86 Å

PDB Description: crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677.
PDB Compounds: (D:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4lyyd_:

Sequence, based on SEQRES records: (download)

>d4lyyd_ c.61.1.0 (D:) automated matches {Shewanella pealeana [TaxId: 398579]}
khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei
dfmsvssygnemsssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepks
lalctlldkperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvvp

Sequence, based on observed residues (ATOM records): (download)

>d4lyyd_ c.61.1.0 (D:) automated matches {Shewanella pealeana [TaxId: 398579]}
khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei
dfmsvssyrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepkslalctll
dkperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvvp

SCOPe Domain Coordinates for d4lyyd_:

Click to download the PDB-style file with coordinates for d4lyyd_.
(The format of our PDB-style files is described here.)

Timeline for d4lyyd_: