SCOPe 2.06: Domain d4lyyd_: 4lyy D:

Lineage for d4lyyd_ (4lyy D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (32 species)
   not a true protein

7. Species Shewanella pealeana [TaxId:398579] [226751] (1 PDB entry)

8. Domain d4lyyd_: 4lyy D: [224794]
   Other proteins in same PDB: d4lyya2
   automated match to d2vfaa_
   complexed with po4

Details for d4lyyd_

PDB Entry: 4lyy, 1.86 Å

PDB Description: crystal structure of hypoxanthine phosphoribosyltransferase from shewanella pealeana atcc 700345, nysgrc target 029677.

PDB Compounds: (D:) hypoxanthine phosphoribosyltransferase

SCOPe Domain Sequences for d4lyyd_:

Sequence, based on SEQRES records:

>d4lyyd_ c.61.1.0 (D:) automated matches {Shewanella pealeana [TaxId: 398579]}
khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei
dfmsvssygnemsssrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepks
lalctlldkperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvvp

Sequence, based on observed residues (ATOM records):

>d4lyyd_ c.61.1.0 (D:) automated matches {Shewanella pealeana [TaxId: 398579]}
khttevmitaeeidqkldilaeqinahyadsdrllmvgllkgsvvfmadlcrrikghvei
dfmsvssyrdvkilkdvqseiqgrdvlivedlidsgntlnkvrdmlllrepkslalctll
dkperrevdvpvdfigftipdefivgygidyaeqyrnlpyiakvvp

Timeline for d4lyyd_:

• d4lyyd_ first appeared in SCOPe 2.03
  
• d4lyyd_ appears in SCOPe 2.05
  
• d4lyyd_ appears in SCOPe 2.07
  
• d4lyyd_ appears in the current release, SCOPe 2.08