SCOPe 2.08: Domain d4louc1: 4lou C:1-121

Lineage for d4louc1 (4lou C:1-121)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (62 PDB entries)
   Uniprot P01811 # HV41_MOUSE (P01811) Ig heavy chain V region UPC10

8. Domain d4louc1: 4lou C:1-121 [224735]
   Other proteins in same PDB: d4loua_, d4loub_, d4louc2, d4loud1, d4loud2, d4loue2, d4louf1, d4louf2
   automated match to d1otsc1
   mutant

Details for d4louc1

PDB Entry: 4lou, 2.98 Å

PDB Description: Structure of the E148Q mutant of CLC-ec1 deltaNC construct in the absence of halide

PDB Compounds: (C:) Fab heavy chain

SCOPe Domain Sequences for d4louc1:

Sequence; same for both SEQRES and ATOM records:

>d4louc1 b.1.1.1 (C:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evrllesggglvqpggslklscaasgfdysrywmswvrqapgkglkwigeinpvsstiny
tpslkdkfiisrdnakdtlylqiskvrsedtalyycarlyygygywyfdvwgagttvtvs
s

Timeline for d4louc1:

• d4louc1 first appeared in SCOPe 2.03
  
• d4louc1 appears in SCOPe 2.07