Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.5: p53-like transcription factors [49417] (7 families) |
Family b.2.5.4: T-box [81316] (3 proteins) |
Protein T domain from Brachyury transcription factor [49433] (1 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [49434] (1 PDB entry) |
Domain d1xbra_: 1xbr A: [22458] protein/DNA complex |
PDB Entry: 1xbr (more details), 2.5 Å
SCOPe Domain Sequences for d1xbra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xbra_ b.2.5.4 (A:) T domain from Brachyury transcription factor {African clawed frog (Xenopus laevis) [TaxId: 8355]} elkvsleerdlwtrfkeltnemivtkngrrmfpvlkvsmsgldpnamytvlldfvaadnh rwkyvngewvpggkpepqapscvyihpdspnfgahwmkdpvsfskvkltnkmngggqiml nslhkyeprihivrvggtqrmitshsfpetqfiavtayqneeitalkikhnpfakaflda kern
Timeline for d1xbra_: