Lineage for d1xbra_ (1xbr A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1112569Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1112950Superfamily b.2.5: p53-like transcription factors [49417] (7 families) (S)
  5. 1113161Family b.2.5.4: T-box [81316] (3 proteins)
  6. 1113162Protein T domain from Brachyury transcription factor [49433] (1 species)
  7. 1113163Species African clawed frog (Xenopus laevis) [TaxId:8355] [49434] (1 PDB entry)
  8. 1113164Domain d1xbra_: 1xbr A: [22458]
    protein/DNA complex

Details for d1xbra_

PDB Entry: 1xbr (more details), 2.5 Å

PDB Description: t domain from xenopus laevis bound to dna
PDB Compounds: (A:) protein (t protein)

SCOPe Domain Sequences for d1xbra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xbra_ b.2.5.4 (A:) T domain from Brachyury transcription factor {African clawed frog (Xenopus laevis) [TaxId: 8355]}
elkvsleerdlwtrfkeltnemivtkngrrmfpvlkvsmsgldpnamytvlldfvaadnh
rwkyvngewvpggkpepqapscvyihpdspnfgahwmkdpvsfskvkltnkmngggqiml
nslhkyeprihivrvggtqrmitshsfpetqfiavtayqneeitalkikhnpfakaflda
kern

SCOPe Domain Coordinates for d1xbra_:

Click to download the PDB-style file with coordinates for d1xbra_.
(The format of our PDB-style files is described here.)

Timeline for d1xbra_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1xbrb_