SCOPe 2.03: Domain d4l3qa2: 4l3q A:219-460

Lineage for d4l3qa2 (4l3q A:219-460)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (31 PDB entries)

8. Domain d4l3qa2: 4l3q A:219-460 [224553]
   automated match to d1bdga2
   complexed with 926, glc

Details for d4l3qa2

PDB Entry: 4l3q, 2.7 Å

PDB Description: crystal structure of glucokinase-activator complex

PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d4l3qa2:

Sequence; same for both SEQRES and ATOM records:

>d4l3qa2 c.55.1.0 (A:219-460) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
ka

Timeline for d4l3qa2:

• d4l3qa2 is new in SCOPe 2.03-stable
  
• d4l3qa2 appears in SCOPe 2.04
  
• d4l3qa2 appears in the current release, SCOPe 2.08